Package: MFO 0.2.0
MFO: Maximal Fat Oxidation and Kinetics Calculation
Calculate the maximal fat oxidation (MFO), the exercise intensity that elicits MFO (FatMax), the FatMax zone, the crossover point, and the SIN model to represent fat oxidation kinetics. Supports multiple curve-fitting methods (P3, P2, MRER) and stoichiometric equations (Frayn, Jeukendrup, Peronnet). Three variables can be obtained from the SIN model: dilatation, symmetry and translation, plus Fatmin (intensity at negligible fat oxidation). Examples of these methods can be found in Montes de Oca et al (2021) <doi:10.1080/17461391.2020.1788650>, Cheneviere et al. (2009) <doi:10.1249/MSS.0b013e31819e2f91>, and Achten et al. (2002) <doi:10.1097/00005768-200211000-00015>.
Authors:
MFO_0.2.0.tar.gz
MFO_0.2.0.zip(r-4.7)MFO_0.2.0.zip(r-4.6)MFO_0.2.0.zip(r-4.5)
MFO_0.2.0.tgz(r-4.6-any)MFO_0.2.0.tgz(r-4.5-any)
MFO_0.2.0.tar.gz(r-4.7-any)MFO_0.2.0.tar.gz(r-4.6-any)
MFO_0.2.0.tgz(r-4.6-emscripten)
manual.pdf |manual.html✨
DESCRIPTION |NEWS
card.svg |card.png
MFO/json (API)
| # Install 'MFO' in R: |
| install.packages('MFO', repos = c('https://jorgedelro.r-universe.dev', 'https://cloud.r-project.org')) |
Bug tracker:https://github.com/jorgedelro/mfo/issues
Last updated from:50b59790cc. Checks:9 OK. Indexed: yes.
| Target | Result | Time | Files | Syslog |
|---|---|---|---|---|
| linux-devel-x86_64 | OK | 142 | ||
| source / vignettes | OK | 212 | ||
| linux-release-x86_64 | OK | 142 | ||
| macos-release-arm64 | OK | 165 | ||
| macos-oldrel-arm64 | OK | 213 | ||
| windows-devel | OK | 163 | ||
| windows-release | OK | 92 | ||
| windows-oldrel | OK | 89 | ||
| wasm-release | OK | 106 |
Exports:MFOMFO_kineticsMFOs
Dependencies:cellrangerclicpp11crayondplyrfarvergenericsggplot2gluegtablehmsisobandlabelinglifecyclemagrittrminpack.lmopenxlsxpillarpkgconfigprettyunitsprogresspurrrR6RColorBrewerRcppreadxlrematchrlangS7scalesstringistringrtibbletidyrtidyselectutf8vctrsviridisLitewithrzip
Readme and manuals
Help Manual
| Help page | Topics |
|---|---|
| Basal test dataframe | basal_df |
| Calculate step means from raw data | calculate_vars |
| Calculate MFO using the MRER method (Perez-Martin et al.) | fat_oxidation_MRER |
| Basal metabolic rate | met_basal |
| Maximal Fat Oxidation & FatMax Function | MFO |
| MFO test dataframe | MFO_df |
| Maximal Fat Oxidation Kinetics (SIN Model) | MFO_kinetics |
| Maximal Fat Oxidation calculation of multiple databases | MFOs |
| Preprocess breath-by-breath data into fixed intervals | preprocess_bxb |
| Read databases for MFO package | read_MFO_databases |
| Substrate oxidation equations | substrate_oxidation |
| Graded exercise test dataframe | VO2max_df |
